PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM08G05340.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 744aa    MW: 79638.8 Da    PI: 5.3929
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM08G05340.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox35.32e-11109149141
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-H CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLte 41 
                      +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+ 
  OGLUM08G05340.1 109 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEP 149
                      688999*********************************86 PP

2START209.81.1e-652905111206
                      HHHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEE CS
            START   1 elaeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                      ela +a++elv++a+++ p+W++ss      +++++e+ + f+++ +      ++ea+r  +vv+m++ +lve+l+d++ q+ + +     +a+
  OGLUM08G05340.1 290 ELAVAAMDELVQMAQLDGPLWSSSSsgpaaMMLDEEEYARMFPRGLGpkqygLKSEASRHGAVVIMTHSNLVEILMDVN-QFATVFSsivsRAS 382
                      57899************************99***********998889*******************************.88888888888*** PP

                      EEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
            START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwv 167
                      t+ev+s+g      galq+m++e+q++splvp R+++fvRy++  ++g+w++vdvS+ds ++ p    v +++++pSg+li++++ng+skvtwv
  OGLUM08G05340.1 383 THEVLSTGvagnynGALQVMSMEFQVPSPLVPtRESYFVRYCKNNSDGTWAVVDVSLDSLRPSP----VLKCRRRPSGCLIQEMPNGYSKVTWV 472
                      **************************************************************98....7************************* PP

                      E-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
            START 168 ehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                      ehv+++++++h+++++lv+sgla+gak+wv tl+rqce+
  OGLUM08G05340.1 473 EHVEVDDSSVHNIYKPLVNSGLAFGAKRWVGTLDRQCER 511
                      *************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.41E-1096151IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.2E-1497151IPR009057Homeodomain-like
SMARTSM003894.7E-4107161IPR001356Homeobox domain
CDDcd000862.17E-10108151No hitNo description
PfamPF000464.8E-9109149IPR001356Homeobox domain
PROSITE profilePS5084839.232281514IPR002913START domain
SuperFamilySSF559612.29E-34282513No hitNo description
CDDcd088752.13E-120285510No hitNo description
SMARTSM002341.8E-62290511IPR002913START domain
PfamPF018522.2E-54291511IPR002913START domain
Gene3DG3DSA:3.30.530.205.4E-6357510IPR023393START-like domain
SuperFamilySSF559612.47E-16533734No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 744 aa     Download sequence    Send to blast
MTPARRMPPV IGRNGVAYGS PSAQLPLTQA DMLDSHHLQQ ALQQQYFDQI PVTTAAAAAA  60
DSGDNMLHGR ADAGGLVDEF ESKSCSENVD GAGDGLSGDD QDPNQRPRKK RYHRHTQHQI  120
QEMEAFFKEC PHPDDKQRKE LSRELGLEPL QNQHERHENA QLRAENDKLR AENMRYKEAL  180
SSASCPNCGG PAALGEMSFD EHHLRVENAR LRDEIDRISG IAAKHVGKPP IVSFPVLSSP  240
LAAAAARSPL DLAGAYGVVT PGLDMFAGAG AGDLLRGVHP LDADKPMIVE LAVAAMDELV  300
QMAQLDGPLW SSSSSGPAAM MLDEEEYARM FPRGLGPKQY GLKSEASRHG AVVIMTHSNL  360
VEILMDVNQF ATVFSSIVSR ASTHEVLSTG VAGNYNGALQ VMSMEFQVPS PLVPTRESYF  420
VRYCKNNSDG TWAVVDVSLD SLRPSPVLKC RRRPSGCLIQ EMPNGYSKVT WVEHVEVDDS  480
SVHNIYKPLV NSGLAFGAKR WVGTLDRQCE RLASAMASNI PNGDLGVITS VEGRKSMLKL  540
AERMVASFCG GVTASVAHQW TTLSGSGAED VRVMTRKSVD DPGRPPGIVL NAATSFWLPV  600
PPAAVFDFLR DETSRSESAN SNQSNMLILQ ESCTDASGSY VVYAPVDIVA MNVVLNGGDP  660
DYVALLPSGF AILPDGPSGN AQAAVGENGS GSGGGSLLTV AFQILVDSVP TAKLSLGSVA  720
TVNSLIACTV ERIKAAVCRD SNPQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0779930.0AB077993.1 Oryza sativa mRNA for Roc1, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650023.10.0PREDICTED: homeobox-leucine zipper protein ROC1 isoform X2
SwissprotQ6ZAR00.0ROC1_ORYSJ; Homeobox-leucine zipper protein ROC1
TrEMBLA0A0E0ARP60.0A0A0E0ARP6_9ORYZ; Uncharacterized protein
STRINGLOC_Os08g08820.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2